PDB entry 1wgd

View 1wgd on RCSB PDB site
Description: Solution structure of the Ubl-domain of Herp
Class: membrane protein
Keywords: Endplasmic reticulum stress, Ubl domain, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, MEMBRANE PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA ha00594
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15011 (7-87)
      • cloning artifact (0-6)
      • cloning artifact (88-92)
    Domains in SCOPe 2.02: d1wgda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgdA (A:)
    gssgssgvtllvkspnqrhrdlelsgdrgwsvghlkahlsrvyperprpedqrliysgkl
    lldhqclrdllpkqekrhvlhlvcnvksgpssg