PDB entry 1wgb

View 1wgb on RCSB PDB site
Description: Crystal structure of a probable flavoprotein from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: flavoprotein, HB8, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: probable flavoprotein
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q72LK7 (0-158)
  Domains in SCOPe 2.08: d1wgba_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wgbA (A:)
  mnleakkkvlrsftyglyvltakdgdevaagtvnwvtqasfqpplvavglkrdshlhalv
  ertgklalmtlahdqkaiaqdffkptvregdrlnghpfepsptfglplltelpywleaev
  rhlypggdhslvvaevveagvrreekplvmwdtgwfygg