PDB entry 1wgb

View 1wgb on RCSB PDB site
Description: Crystal structure of a probable flavoprotein from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: flavoprotein, HB8, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable flavoprotein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wgba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgbA (A:)
    mnleakkkvlrsftyglyvltakdgdevaagtvnwvtqasfqpplvavglkrdshlhalv
    ertgklalmtlahdqkaiaqdffkptvregdrlnghpfepsptfglplltelpywleaev
    rhlypggdhslvvaevveagvrreekplvmwdtgwfygg