PDB entry 1wg8

View 1wg8 on RCSB PDB site
Description: Crystal structure of a predicted S-adenosylmethionine-dependent methyltransferase TT1512 from Thermus thermophilus HB8.
Class: transferase
Keywords: S-adenosyl-methyltransferase, mraW, Thermus thermophilus, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: predicted S-adenosylmethionine-dependent methyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Gene: TT1512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wg8a1, d1wg8a2
  • Chain 'B':
    Compound: predicted S-adenosylmethionine-dependent methyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Gene: TT1512
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wg8b1, d1wg8b2
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wg8A (A:)
    mrpmthvpvlyqealdllavrpggvyvdatlggaghargilerggrvigldqdpeavara
    kglhlpgltvvqgnfrhlkrhlaalgvervdgiladlgvssfhlddpsrgfsyqkegpld
    mrmglegptakevvnrlplealarllrelgeepqayriaraivaarekapietttqlaei
    vrkavgfrraghparktfqalriyvndelnalkefleqaaevlapggrlvviafhsledr
    vvkrflresglkvltkkplvpsekeaaqnprarsaklraaekeap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wg8A (A:)
    mthvpvlyqealdllavrpggvyvdatlggaghargilerggrvigldqdpeavarakgl
    hlpgltvvqgnfrhlkrhlaalgvervdgiladlgvssfhlddpsrgfsyqkegpldmrm
    glegptakevvnrlplealarllrelgeepqayriaraivaarekapietttqlaeivrk
    avgfrraghparktfqalriyvndelnalkefleqaaevlapggrlvviafhsledrvvk
    rflresglkvltkkplvpsekeaaqnprarsaklraaekea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wg8B (B:)
    mrpmthvpvlyqealdllavrpggvyvdatlggaghargilerggrvigldqdpeavara
    kglhlpgltvvqgnfrhlkrhlaalgvervdgiladlgvssfhlddpsrgfsyqkegpld
    mrmglegptakevvnrlplealarllrelgeepqayriaraivaarekapietttqlaei
    vrkavgfrraghparktfqalriyvndelnalkefleqaaevlapggrlvviafhsledr
    vvkrflresglkvltkkplvpsekeaaqnprarsaklraaekeap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wg8B (B:)
    thvpvlyqealdllavrpggvyvdatlggaghargilerggrvigldqdpeavarakglh
    lpgltvvqgnfrhlkrhlaalgvervdgiladlgvssfhlddpsrgfsyqkegpldmrmg
    legptakevvnrlplealarllrelgeepqayriaraivaarekapietttqlaeivrka
    vgfrraghparktfqalriyvndelnalkefleqaaevlapggrlvviafhsledrvvkr
    flresglkvltkkplvpsekeaaqnprarsaklraaekea