PDB entry 1wg7

View 1wg7 on RCSB PDB site
Description: Solution structure of pleckstrin homology domain from human KIAA1058 protein
Class: signaling protein
Keywords: pleckstrin homology domain, zizimin1, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dedicator of cytokinesis protein 9
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA hh12146s1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BZ29 (7-143)
    • cloning artifact (0-6)
    • cloning artifact (144-149)
  Domains in SCOPe 2.05: d1wg7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wg7A (A:)
  gssgssgaaslgsqkggitkhgwlykgnmnsaisvtmrsfkrrffhliqlgdgsynlnfy
  kdekiskepkgsifldscmgvvqnnkvrrfafelkmqdkssyllaadsevemeewitiln
  kilqlnfeaamqekrngdsheddesgpssg