PDB entry 1wg6

View 1wg6 on RCSB PDB site
Description: Solution structure of PDZ domain in protein XP_110852
Class: DNA binding protein
Keywords: NMR, structural genomics, PDZ domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HYPOTHETICAL PROTEIN (RIKEN cDNA 2810455B10)
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2010002N16
    Database cross-references and differences (RAF-indexed):
    • GB XP_110852 (7-120)
      • cloning artifact (0-6)
      • cloning artifact (121-126)
    Domains in SCOPe 2.07: d1wg6a1, d1wg6a2, d1wg6a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wg6A (A:)
    gssgssglkgepdcyalslesseqltleiplndsgsaglgvslkgnksretgtdlgifik
    siihggaafkdgrlrmndqliavngetllgksnheametlrrsmsmegnirgmiqlvilr
    rsgpssg