PDB entry 1wg3

View 1wg3 on RCSB PDB site
Description: Structural analysis of yeast nucleosome-assembly factor CIA1p
Class: replication
Keywords: BETA-SANDWICH, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, REPLICATION
Deposited on 2004-05-27, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.198
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-silencing protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32447 (6-End)
      • cloning artifact (0-5)
    Domains in SCOPe 2.07: d1wg3a1, d1wg3a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wg3A (A:)
    asgssgmsivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhd
    qeldsilvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvn
    neydeeelrenppakvqvdhivrnilaekprvtrfnivwdnenegdlyppeqpgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wg3A (A:)
    asgssgmsivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhd
    qeldsilvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvn
    neydeeelrenppakvqvdhivrnilaekprvtrfnivwdnenegd