PDB entry 1wg2

View 1wg2 on RCSB PDB site
Description: Solution structure of zf-AN1 domain from Arabidopsis thaliana
Class: DNA binding protein
Keywords: zinc finger, AN1, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc finger (AN1-like) family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RIKEN cDNA RAFL09-11-C11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SZ69 (7-57)
      • cloning artifact (0-6)
      • cloning artifact (58-63)
    Domains in SCOPe 2.06: d1wg2a1, d1wg2a2, d1wg2a3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wg2A (A:)
    gssgssgpsrpvrpnnrcfscnkkvgvmgfkckcgstfcgshrypekhecsfdfkevgsg
    pssg