PDB entry 1wg2

View 1wg2 on RCSB PDB site
Description: solution structure of zf-an1 domain from arabidopsis thaliana
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-27, with a file datestamp of 2004-11-27.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wg2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wg2A (A:)
    gssgssgpsrpvrpnnrcfscnkkvgvmgfkckcgstfcgshrypekhecsfdfkevgsg
    pssg