PDB entry 1wg0

View 1wg0 on RCSB PDB site
Description: Structural comparison of Nas6p protein structures in two different crystal forms
Class: protein binding
Keywords: Ankyrin repeats, gankyrin homolog, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, PROTEIN BINDING
Deposited on 2004-05-27, released 2005-06-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.179
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Probable 26S proteasome regulatory subunit p28
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50086 (0-227)
    • expression tag (228-242)
  Domains in SCOPe 2.05: d1wg0a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wg0A (A:)
  msnyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskme
  nvnlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwf
  evsqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfh
  alaeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnvvdklaaalehhh
  hhh