PDB entry 1wfz

View 1wfz on RCSB PDB site
Description: Solution structure of Iron-sulfur cluster protein U (IscU)
Class: metal transport
Keywords: Iron-sulfur cluster biosynthesis, three conserved Cys, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL TRANSPORT
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen fixation cluster-like
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2300003J05
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D7P6 (7-123)
      • cloning artifact (0-6)
      • cloning artifact (124-129)
    Domains in SCOPe 2.08: d1wfza1, d1wfza2, d1wfza3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wfzA (A:)
gssgssgenprnvgsldktsknvgtglvgapacgdvmklqiqvdekgkivdarfktfgcg
saiassslatewvkgktveealtikntdiakelclppvklhcsmlaedaikaaladyklk
qesksgpssg