PDB entry 1wfy

View 1wfy on RCSB PDB site
Description: Solution structure of the Ras-binding domain of mouse RGS14
Class: signaling protein
Keywords: Regulators of G-protein signaling, Ras family, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulator of G-protein signaling 14; rap1/rap2 interacting protein
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 0610041O18
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97492 (7-97)
      • cloning artifact (0-6)
      • cloning artifact (98-103)
    Domains in SCOPe 2.05: d1wfya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfyA (A:)
    gssgssgdqevrlenritfqlelvglervvrisakptkrlqealqpilakhglsldqvvl
    hrpgekqpmdlenpvssvasqtlvldtppdakmsearssgpssg