PDB entry 1wfx

View 1wfx on RCSB PDB site
Description: Crystal Structure of APE0204 from Aeropyrum pernix
Class: transferase
Keywords: RNA 2'-phosphotransferase, tRNA splicing, NAD, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, transferase
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable RNA 2'-phosphotransferase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: APE0204
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YFP5
      • modified residue (106)
      • modified residue (111)
      • modified residue (158)
    Domains in SCOPe 2.07: d1wfxa_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wfxA (A:)
    mrvrlsktlagilrhhpgrygvrltregwarvsevveglrkagwswveewhivgvalhdp
    kgryelrngeiraryghsipvnveplpgepppilyhgtteealplimergimrgrrlkvh
    ltssledavstgrrhgnlvavllvdveclrrrglkvermsktvytvdwvppeciaevrre
    slgrsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wfxA (A:)
    vrlsktlagilrhhpgrygvrltregwarvsevveglrkagwswveewhivgvalhdpkg
    ryelrngeiraryghsipvnveplpgepppilyhgtteealplimergimrgrrlkvhlt
    ssledavstgrrhgnlvavllvdveclrrrglkvermsktvytvdwvppeciaevrresl