PDB entry 1wfv

View 1wfv on RCSB PDB site
Description: Solution structure of the fifth PDZ domain of human membrane associated guanylate kinase inverted-2 (KIAA0705 protein)
Class: signaling protein
Keywords: atrophin-1 interacting protein 1, activin receptor interacting protein 1, membrane associated guanylate kinase inverted-2, activin type IIA receptor, AIP1, ARIP1, Acvrip1, ActRIIA, MAGI-2, PDZ domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: membrane associated guanylate kinase inverted-2
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA hg03359
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q86UL8 (7-96)
    • cloning artifact (0-6)
    • cloning artifact (97-102)
  Domains in SCOPe 2.06: d1wfva1, d1wfva2, d1wfva3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wfvA (A:)
  gssgssgqdfdyftvdmekgakgfgfsirggreykmdlyvlrlaedgpairngrmrvgdq
  iieingestrdmtharaieliksggrrvrlllkrgtgsgpssg