PDB entry 1wfu

View 1wfu on RCSB PDB site
Description: Solution structure of fibronectin type III domain of mouse hypothetical protein
Class: structural genomics, unknown function
Keywords: FN3 domain, similar to 1700007B22Rik protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unnamed protein product
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 4933435J10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DAM9 (7-113)
      • cloning artifact (0-6)
      • cloning artifact (114-119)
    Domains in SCOPe 2.07: d1wfua1, d1wfua2, d1wfua3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfuA (A:)
    gssgssgmephkvvplskphppvvgkvthhsielywdleqkekrqgpqeqwlrfsieeed
    pkmhsygviytgyatrhvvegleprtlykfrlkvtspsgeyeyspvvsvattresgpssg