PDB entry 1wft

View 1wft on RCSB PDB site
Description: Solution structure of C-terminal fibronectin type III domain of mouse 1700129L13Rik protein
Class: protein binding
Keywords: FN3 domain, similar to host cell factor 2, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-26, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1700129L13Rik protein
    Species: MUS MUSCULUS
    Gene: RIKEN cDNA 1700129L13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D968 (7-116)
      • cloning artifact (0-6)
      • cloning artifact (117-122)
    Domains in SCOP 1.73: d1wfta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wftA (A:)
    gssgssgpgapstvrisknvdgihlswepptspsgnileysaylairtaqmqdnpsqlvf
    mriycglktsctvtagqlanahidytsrpaivfrisaknekgygpatqirwlqgnsksgp
    ssg