PDB entry 1wfs

View 1wfs on RCSB PDB site
Description: Solution Structure of Glia Maturation Factor-gamma from Mus Musculus
Class: protein binding
Keywords: ACTIN BINDING PROTEIN, CYTOSKELETON, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glia maturation factor gamma
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2310057N07
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ERL7 (7-144)
      • cloning artifact (0)
      • cloning aetifact (1)
      • cloning artifact (2-6)
      • cloning artifact (145-150)
    Domains in SCOPe 2.07: d1wfsa1, d1wfsa2, d1wfsa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfsA (A:)
    gssgssgsdslvvcevdpelketlrkfrfrketnnaaiimkvdkdrqmvvledelqnisp
    eelklelperqprfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsknrlvqt
    aeltkvfeirttddltetwlkeklasgpssg