PDB entry 1wfr

View 1wfr on RCSB PDB site
Description: Solution structure of the conserved hypothetical protein TT1886, possibly sterol carrier protein, from Thermus Thermophilus HB8
Class: lipid binding protein
Keywords: STEROL CARRIER PROTEIN, NMR, STRUCTURAL GENOMICS, LIPID BINDING, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-26, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical Protein TT1886
    Species: Thermus thermophilus HB8
    Domains in SCOP 1.73: d1wfra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfrA (A:)
    gssgssgmelfteawaqaycrklneseayrkaastwegslalavrpdpkagfpkgvavvl
    dlwhgacrgakavegeaeadfvieadlatwqevlegrleplsalmrgllelkkgtiaala
    pyaqaaqelvkvarevasgpssg