PDB entry 1wfq

View 1wfq on RCSB PDB site
Description: Solution structure of the first cold-shock domain of the human KIAA0885 protein (UNR protein)
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-26, with a file datestamp of 2004-11-26.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1wfqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wfqA (A:)
  gssgssggypngtsaalretgvieklltsygfiqcserqarlffhcsqyngnlqdlkvgd
  dvefevssdrrtgkpiavklvkisgpssg