PDB entry 1wfn

View 1wfn on RCSB PDB site
Description: The fourth FN3 domain of human sidekick-2
Class: cell adhesion
Keywords: sidekick-2, fn3, cell adhesion, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-26, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sidekick 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA fh00815
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58EX2 (7-112)
      • cloning artifact (0-6)
      • cloning artifact (113-118)
    Domains in SCOPe 2.07: d1wfna1, d1wfna2, d1wfna3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfnA (A:)
    gssgssgpqlvrthedvpgpvghlsfseildtslkvswqepgekngiltgyrisweeynr
    tntrvthylpnvtleyrvtgltalttytievaamtskgqgqvsastissgvppsgpssg