PDB entry 1wfl

View 1wfl on RCSB PDB site
Description: Solution structure of the zf-AN1 domain from mouse zinc finger protein 216
Class: metal binding protein
Keywords: zf-AN1 domain, zinc binding, zinc finger protein 216, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc finger protein 216
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2210411M18
  Database cross-references and differences (RAF-indexed):
  • Uniprot O88878 (7-67)
    • cloning artifact (0-6)
    • cloning artifact (68-73)
  Domains in SCOPe 2.07: d1wfla1, d1wfla2, d1wfla3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wflA (A:)
  gssgssgpsssqseekapelpkpkknrcfmcrkkvgltgfdcrcgnlfcglhrysdkhnc
  pydykaeasgpssg