PDB entry 1wfk

View 1wfk on RCSB PDB site
Description: FYVE domain of FYVE domain containing 19 protein from Mus musculus
Class: unknown function
Keywords: FYVE domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc finger, FYVE domain containing 19
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1500041L05
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DAZ9 (7-81)
      • cloning artifact (0-6)
      • cloning artifact (82-87)
    Domains in SCOPe 2.08: d1wfka1, d1wfka2, d1wfka3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfkA (A:)
    gssgssgmesrcygcavkftlfkkeygckncgrafcngclsfsalvpragntqqkvckqc
    htiltrgssdnaskwsppqnyksgpssg