PDB entry 1wfj

View 1wfj on RCSB PDB site
Description: C2 domain-containing protein from putative elicitor-responsive gene
Class: plant protein
Keywords: C2 domain, elicitor-responsive gene, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-26, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: putative elicitor-responsive gene
  Species: Arabidopsis thaliana
  Gene: RIKEN cDNA RAFL05-11-F09
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9C8S6 (7-129)
    • cloning artifact (0-6)
    • cloning artifact (130-135)
  Domains in SCOP 1.73: d1wfja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wfjA (A:)
  gssgssgphgtlevvlvsakgledadflnnmdpyvqltcrtqdqksnvaegmgttpewne
  tfiftvsegttelkakifdkdvgteddavgeatiplepvfvegsipptaynvvkdeeykg
  eiwvalsfkpsgpssg