PDB entry 1wfj

View 1wfj on RCSB PDB site
Description: c2 domain-containing protein from putative elicitor-responsive gene
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-26, with a file datestamp of 2004-11-26.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wfja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfjA (A:)
    gssgssgphgtlevvlvsakgledadflnnmdpyvqltcrtqdqksnvaegmgttpewne
    tfiftvsegttelkakifdkdvgteddavgeatiplepvfvegsipptaynvvkdeeykg
    eiwvalsfkpsgpssg