PDB entry 1wfj

View 1wfj on RCSB PDB site
Description: C2 domain-containing protein from putative elicitor-responsive gene
Class: plant protein
Keywords: C2 domain, elicitor-responsive gene, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, PLANT PROTEIN
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative elicitor-responsive gene
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RIKEN cDNA RAFL05-11-F09
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C8S6 (7-129)
      • cloning artifact (0-6)
      • cloning artifact (130-135)
    Domains in SCOPe 2.08: d1wfja1, d1wfja2, d1wfja3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfjA (A:)
    gssgssgphgtlevvlvsakgledadflnnmdpyvqltcrtqdqksnvaegmgttpewne
    tfiftvsegttelkakifdkdvgteddavgeatiplepvfvegsipptaynvvkdeeykg
    eiwvalsfkpsgpssg