PDB entry 1wfi

View 1wfi on RCSB PDB site
Description: Nuclear move domain of nuclear distribution gene C homolog
Class: transport protein
Keywords: NudC, nuclear distribution, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSPORT PROTEIN
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear distribution gene C homolog
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2700033I24
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35685 (7-124)
      • cloning artifact (0-6)
      • cloning artifact (125-130)
    Domains in SCOPe 2.06: d1wfia1, d1wfia2, d1wfia3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfiA (A:)
    gssgssgpnyrwtqtlaeldlavpfrvsfrlkgkdvvvdiqrrhlrvglkgqppvvdgel
    ynevkveesswliedgkvvtvhlekinkmewwnrlvtsdpeintkkinpensklsdldse
    trsmvsgpssg