PDB entry 1wfi

View 1wfi on RCSB PDB site
Description: Nuclear move domain of nuclear distribution gene C homolog
Class: transport protein
Keywords: NudC, nuclear distribution, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSPORT PROTEIN
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nuclear distribution gene C homolog
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2700033I24
  Database cross-references and differences (RAF-indexed):
  • Uniprot O35685 (7-124)
    • cloning artifact (0-6)
    • cloning artifact (125-130)
  Domains in SCOPe 2.05: d1wfia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wfiA (A:)
  gssgssgpnyrwtqtlaeldlavpfrvsfrlkgkdvvvdiqrrhlrvglkgqppvvdgel
  ynevkveesswliedgkvvtvhlekinkmewwnrlvtsdpeintkkinpensklsdldse
  trsmvsgpssg