PDB entry 1wfh

View 1wfh on RCSB PDB site
Description: Solution structrue of the zf-AN1 domain from Arabidopsis thaliana At2g36320 protein
Class: metal binding protein
Keywords: zf-AN1 domain, zinc binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc finger (AN1-like) family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RIKEN cDNA RAFL09-30-H08
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SJM6 (7-57)
      • cloning artifact (0-6)
      • cloning artifact (58-63)
    Domains in SCOPe 2.08: d1wfha1, d1wfha2, d1wfha3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfhA (A:)
    gssgssgqpsppqrpnrctvcrkrvgltgfmcrcgttfcgshrypevhgctfdfksagsg
    pssg