PDB entry 1wfg

View 1wfg on RCSB PDB site
Description: PDZ domain of human RIM2B
Class: endocytosis/exocytosis
Keywords: PDZ domain, exocytosis, Rab3-interacting molecule, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2004-05-26, released 2004-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulating synaptic membrane exocytosis protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA hk04424
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQ26 (7-124)
      • cloning artifact (0-6)
      • cloning artifact (125-130)
    Domains in SCOPe 2.08: d1wfga1, d1wfga2, d1wfga3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfgA (A:)
    gssgssghshsdkhpvtwqpskdgdrligrillnkrlkdgsvprdsgamlglkvvggkmt
    esgrlcafitkvkkgsladtvghlrpgdevlewngrllqgatfeevyniileskpepqve
    lvvsrsgpssg