PDB entry 1wff

View 1wff on RCSB PDB site
Description: Solution structure of the zf-AN1 domain from mouse RIKEN cDNA 2810002D23 protein
Class: metal binding protein
Keywords: zf-AN1 domain, Zinc binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RIKEN cDNA 2810002D23 protein
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 1700043I15
  Database cross-references and differences (RAF-indexed):
  • GB XP_132758 (7-78)
    • cloning artifact (0-6)
    • engineered (61)
    • cloning artifact (79-84)
  Domains in SCOPe 2.08: d1wffa1, d1wffa2, d1wffa3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wffA (A:)
  gssgssgihhlppvkaplqtkkkimkhcflcgkktglatsfecrcgnnfcashryaeahg
  cnydyksagrryleeanpvsgpssg