PDB entry 1wfe

View 1wfe on RCSB PDB site
Description: Solution structure of the 2nd zf-AN1 domain of mouse RIKEN cDNA 2310008M20 protein
Class: metal binding protein
Keywords: zf-AN1 domain, zinc binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RIKEN cDNA 2310008M20 protein
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 5730471C05
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8BFR6 (7-79)
    • cloning artifact (0-6)
    • cloning artifact (80-85)
  Domains in SCOPe 2.08: d1wfea1, d1wfea2, d1wfea3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wfeA (A:)
  gssgssgcsevnvvkerpktdehksyscsfkgctdvelvavicpyceknfclrhrhqsdh
  dceklevakprmaatqklvrsgpssg