PDB entry 1wfd

View 1wfd on RCSB PDB site
Description: Solution structure of mouse MIT domain
Class: structural genomics, unknown function
Keywords: MIT domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein 1500032H18
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1500032H18
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VDV8 (7-86)
      • cloning artifact (0-6)
      • cloning artifact (87-92)
    Domains in SCOPe 2.05: d1wfda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wfdA (A:)
    gssgssgqdsdstaavavlkraveldaesryqqalvcyqegidmllqvlkgtkesskrcv
    lrtkisgymdraenikkyldqekedgksgpssg