PDB entry 1wfc

View 1wfc on RCSB PDB site
Description: structure of apo, unphosphorylated, p38 mitogen activated protein kinase p38 (p38 map kinase) the mammalian homologue of the yeast hog1 protein
Class: transferase
Keywords: p38 map kinase, serine/threonine protein kinase, transferase
Deposited on 1996-09-13, released 1997-09-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitogen-activated protein kinase p38
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wfca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wfcA (A:)
    gshmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wfcA (A:)
    rptfyrqeltiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiihak
    rtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddh
    vqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildftddemtgyvatrwyrap
    eimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkis
    sesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqy
    hdpddepvadpydqsfesrdllidewksltydevisfvpp