PDB entry 1wfc

View 1wfc on RCSB PDB site
Description: structure of apo, unphosphorylated, p38 mitogen activated protein kinase p38 (p38 map kinase) the mammalian homologue of the yeast hog1 protein
Deposited on 1996-09-13, released 1997-09-19
The last revision prior to the SCOP 1.55 freeze date was dated 1997-09-19, with a file datestamp of 1997-09-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1wfc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1wfc_ (-)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
    trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
    ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
    hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wfc_ (-)
    rptfyrqeltiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiihak
    rtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddh
    vqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildftddemtgyvatrwyrap
    eimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkis
    sesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqy
    hdpddepvadpydqsfesrdllidewksltydevisfvpp