PDB entry 1wf8

View 1wf8 on RCSB PDB site
Description: Solution structure of the PDZ domain of Spinophilin/NeurabinII protein
Class: protein binding
Keywords: PDZ domain, Spinophilin/NeurabinII protein, STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-26, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurabin-I
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cNDA fh03567
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULJ8 (7-100)
      • cloning artifact (0-6)
      • cloning artifact (101-106)
    Domains in SCOPe 2.07: d1wf8a1, d1wf8a2, d1wf8a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wf8A (A:)
gssgssglelfpvelekdedglgisiigmgvgadagleklgifvktvteggaaqrdgriq
vndqivevdgislvgvtqnfaatvlrntkgnvrfvigrekpsgpssg