PDB entry 1wf6

View 1wf6 on RCSB PDB site
Description: The third BRCA1 C-terminus (BRCT) domain of Similar to S.pombe rad4+/cut5+ product
Class: cell cycle
Keywords: BRCT, topoisomerase II binding protein, checkpoint, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, CELL CYCLE
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Similar to S.pombe -rad4+/cut5+product (A40727)
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA ha07059
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92547 (7-125)
    • cloning artifact (0-6)
    • cloning artifact (126-131)
  Domains in SCOPe 2.08: d1wf6a1, d1wf6a2, d1wf6a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wf6A (A:)
  gssgssgsesicnslnskleptlenlenldvsafqapedlldgcriylcgfsgrkldklr
  rlinsgggvrfnqlnedvthvivgdyddelkqfwnksahrphvvgakwllecfskgymls
  eepyihsgpssg