PDB entry 1wf4

View 1wf4 on RCSB PDB site
Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
Deposited on 2004-05-25, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'a':
    Sequence, based on SEQRES records: (download)
    >1wf4a (a:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4a (a:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpek
    

  • Chain 'b':
    Sequence, based on SEQRES records: (download)
    >1wf4b (b:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4b (b:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'c':
    Sequence, based on SEQRES records: (download)
    >1wf4c (c:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4c (c:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpek
    

  • Chain 'd':
    Sequence, based on SEQRES records: (download)
    >1wf4d (d:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4d (d:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpek
    

  • Chain 'e':
    Sequence, based on SEQRES records: (download)
    >1wf4e (e:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4e (e:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'f':
    Sequence, based on SEQRES records: (download)
    >1wf4f (f:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4f (f:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpek
    

  • Chain 'g':
    Sequence, based on SEQRES records: (download)
    >1wf4g (g:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4g (g:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'h':
    Sequence, based on SEQRES records: (download)
    >1wf4h (h:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4h (h:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'i':
    Sequence, based on SEQRES records: (download)
    >1wf4i (i:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4i (i:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'j':
    Sequence, based on SEQRES records: (download)
    >1wf4j (j:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4j (j:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'k':
    Sequence, based on SEQRES records: (download)
    >1wf4k (k:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4k (k:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'l':
    Sequence, based on SEQRES records: (download)
    >1wf4l (l:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4l (l:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'm':
    Sequence, based on SEQRES records: (download)
    >1wf4m (m:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4m (m:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'n':
    Sequence, based on SEQRES records: (download)
    >1wf4n (n:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4n (n:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'o':
    Sequence, based on SEQRES records: (download)
    >1wf4o (o:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4o (o:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'p':
    Sequence, based on SEQRES records: (download)
    >1wf4p (p:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4p (p:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'q':
    Sequence, based on SEQRES records: (download)
    >1wf4q (q:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4q (q:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'r':
    Sequence, based on SEQRES records: (download)
    >1wf4r (r:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4r (r:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 's':
    Sequence, based on SEQRES records: (download)
    >1wf4s (s:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4s (s:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 't':
    Sequence, based on SEQRES records: (download)
    >1wf4t (t:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4t (t:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'u':
    Sequence, based on SEQRES records: (download)
    >1wf4u (u:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wf4u (u:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq