PDB entry 1wf0

View 1wf0 on RCSB PDB site
Description: Solution structure of RRM domain in TAR DNA-binding protein-43
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, TAR DNA-binding protein-43, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA binding protein
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TAR DNA-binding protein-43
    Species: Homo sapiens [TaxId:9606]
    Gene: HEP00195
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13148 (7-81)
      • cloning artifact (0-6)
      • see remark 999 (14)
      • cloning artifact (82-87)
    Domains in SCOPe 2.08: d1wf0a1, d1wf0a2, d1wf0a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wf0A (A:)
gssgssgvfvgrctgdmtedelreffsqygdvmdvfipkpfrafafvtfaddqiaqslcg
edliikgisvhisnaepkhnsnsgpssg