PDB entry 1wez

View 1wez on RCSB PDB site
Description: Solution structure of RRM domain in heterogeneous nuclear ribonucleoprotein H'
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, heterogeneous nuclear ribonucleoprotein H', RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Heterogeneous nuclear ribonucleoprotein H'
  Species: Homo sapiens [TaxId:9606]
  Gene: CBL00922
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55795 (7-95)
    • cloning artifact (0-6)
    • cloning artifact (96-101)
  Domains in SCOPe 2.08: d1weza1, d1weza2, d1weza3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wezA (A:)
  gssgssgssfqsttghcvhmrglpyratendiynffsplnpmrvhieigpdgrvtgeadv
  efathedavaamakdkanmqhryvelflnstagtsgsgpssg