PDB entry 1wey

View 1wey on RCSB PDB site
Description: Solution structure of RRM domain in calcipressin 1
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, calcipressin 1, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcipressin 1
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 5033405J21
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JHG6 (7-97)
      • cloning artifact (0-6)
      • cloning artifact (98-103)
    Domains in SCOPe 2.06: d1weya1, d1weya2, d1weya3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1weyA (A:)
gssgssgliacvanddvfsesetrakfeslfrtydkdttfqyfksfkrvrinfsnplsaa
darlrlhkteflgkemklyfaqtlhigsshlappnpdksgpssg