PDB entry 1wev

View 1wev on RCSB PDB site
Description: Solution structure of PHD domain in protein NP_082203
Class: gene regulation
Keywords: NMR, structural genomics, PHD domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RIKEN cDNA 1110020M19
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2810027J24
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D168 (7-81)
      • cloning artifact (0-6)
      • conflict (79)
      • cloning artifact (82-87)
    Domains in SCOPe 2.07: d1weva1, d1weva2, d1weva3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wevA (A:)
    gssgssgaddfamemglacvvcrqmtvasgnqlvecqechnlyhqdchkpqvtdkevndp
    rlvwycarctrqmkrmaqknqksgpssg