PDB entry 1weu

View 1weu on RCSB PDB site
Description: Solution structure of PHD domain in ING1-like protein BAC25009
Class: DNA binding protein
Keywords: NMR, structural genomics, PHD domain, ING1-like protein, DNA BINDING PROTEIN, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inhibitor of growth family, member 4
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 0610039A16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C0D7 (7-84)
      • expression tag (0-6)
      • expression tag (85-90)
    Domains in SCOPe 2.08: d1weua1, d1weua2, d1weua3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1weuA (A:)
    gssgssgspeygmpsvtfgsvhpsdvldmpvdpneptyclchqvsygemigcdnpdcsie
    wfhfacvglttkprgkwfcprcsqesgpssg