PDB entry 1wes

View 1wes on RCSB PDB site
Description: Solution structure of PHD domain in inhibitor of growth family, member 1-like
Class: DNA binding protein
Keywords: NMR, structural genomics, PHD domain, inhibitor of growth family, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inhibitor of growth family, member 1-like
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2810011M06
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ESK4 (7-64)
      • cloning artifact (0-6)
      • cloning artifact (65-70)
    Domains in SCOPe 2.08: d1wesa1, d1wesa2, d1wesa3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wesA (A:)
gssgssgefaidpneptyclcnqvsygemigcdneqcpiewfhfscvsltykpkgkwycp
kcrgdsgpssg