PDB entry 1wer

View 1wer on RCSB PDB site
Description: ras-gtpase-activating domain of human p120gap
Deposited on 1996-11-20, released 1997-12-31
The last revision prior to the SCOP 1.57 freeze date was dated 1997-12-31, with a file datestamp of 1997-12-31.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.221
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1wer__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wer_ (-)
    mpeeeysefkelilqkelhvvyalshvcgqdrtllasillriflhekleslllctlndre
    ismedeattlfrattlastlmeqymkatatqfvhhalkdsilkimeskqscelspsklek
    nedvntnlthllnilselvekifmaseilpptlryiygclqksvqhkwptnttmrtrvvs
    gfvflrlicpailnprmfniisdspspiaartlilvaksvqnlanlvefgakepymegvn
    pfiksnkhrmimfldelgnvpelpdttehsrtdlsrdlaalheicvahsdelrtlsnerg
    aqqhvlkkllaitellqqkqnqyt