PDB entry 1wer

View 1wer on RCSB PDB site
Description: ras-gtpase-activating domain of human p120gap
Class: gtpase activation
Keywords: gtpase activation, ras, gap, signal transduction, growth regulation, cancer
Deposited on 1996-11-20, released 1997-12-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.221
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p120gap
    Species: Homo sapiens [TaxId:9606]
    Gene: GENE FRAGMENT OF P120GAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wera_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1werA (A:)
    mekimpeeeysefkelilqkelhvvyalshvcgqdrtllasillriflhekleslllctl
    ndreismedeattlfrattlastlmeqymkatatqfvhhalkdsilkimeskqscelsps
    kleknedvntnlthllnilselvekifmaseilpptlryiygclqksvqhkwptnttmrt
    rvvsgfvflrlicpailnprmfniisdspspiaartlilvaksvqnlanlvefgakepym
    egvnpfiksnkhrmimfldelgnvpelpdttehsrtdlsrdlaalheicvahsdelrtls
    nergaqqhvlkkllaitellqqkqnqytktndvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1werA (A:)
    mpeeeysefkelilqkelhvvyalshvcgqdrtllasillriflhekleslllctlndre
    ismedeattlfrattlastlmeqymkatatqfvhhalkdsilkimeskqscelspsklek
    nedvntnlthllnilselvekifmaseilpptlryiygclqksvqhkwptnttmrtrvvs
    gfvflrlicpailnprmfniisdspspiaartlilvaksvqnlanlvefgakepymegvn
    pfiksnkhrmimfldelgnvpelpdttehsrtdlsrdlaalheicvahsdelrtlsnerg
    aqqhvlkkllaitellqqkqnqyt