PDB entry 1weq

View 1weq on RCSB PDB site
Description: Solution structure of PHD domain in PHD finger protein 7
Class: gene regulation
Keywords: NMR, structural genomics, PHD domain, PHD finger protein 7, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PHD finger protein 7
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1700010P14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DAG9 (7-78)
      • cloning artifact (0-6)
      • cloning artifact (79-84)
    Domains in SCOPe 2.07: d1weqa1, d1weqa2, d1weqa3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1weqA (A:)
    gssgssgelepgafselyqryrhcdapiclyeqgrdsfedegrwrlilcatcgshgthrd
    csslrpnskkwecneclpasgpssg