PDB entry 1wem

View 1wem on RCSB PDB site
Description: Solution structure of PHD domain in death inducer-obliterator 1(DIO-1)
Class: DNA binding protein
Keywords: NMR, structural genomics, PHD domain, death inducer-obliterator 1(DIO-1), RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Death associated transcription factor 1
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 3830408B01
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8C9B9 (7-69)
    • cloning artifact (0-6)
    • cloning artifact (70-75)
  Domains in SCOPe 2.08: d1wema1, d1wema2, d1wema3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wemA (A:)
  gssgssgecevydpnalycicrqphnnrfmiccdrceewfhgdcvgiseargrllernge
  dyicpnctilsgpssg