PDB entry 1wel

View 1wel on RCSB PDB site
Description: Solution structure of RNA binding domain in NP_006038
Class: RNA binding protein
Keywords: RNA binding protein, STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-25, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 12
    Species: Homo sapiens [TaxId:9606]
    Gene: RIKEN cDNA hk04803s1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NTZ6 (7-117)
      • cloning artufact (0)
      • cloning artifact (1-6)
      • cloning artifact (118-123)
    Domains in SCOPe 2.07: d1wela1, d1wela2, d1wela3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1welA (A:)
gssgssgkspsgqkrsrsrspheagfcvylkglpfeaenkhvidffkkldivedsiyiay
gpngkatgegfvefrneadykaalcrhkqymgnrfiqvhpitkkgmlekidmirkrlqsg
pssg