PDB entry 1wek

View 1wek on RCSB PDB site
Description: Crystal structure of the conserved hypothetical protein TT1465 from Thermus thermophilus HB8
Class: Structural genomics, unknown function
Keywords: Rossmann fold, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TT1465
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1weka_
  • Chain 'B':
    Compound: hypothetical protein TT1465
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wekb_
  • Chain 'C':
    Compound: hypothetical protein TT1465
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wekc_
  • Chain 'D':
    Compound: hypothetical protein TT1465
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wekd_
  • Chain 'E':
    Compound: hypothetical protein TT1465
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1weke_
  • Chain 'F':
    Compound: hypothetical protein TT1465
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wekf_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wekA (A:)
    mpkkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyr
    lgralaeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslry
    ffvrkvlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwl
    aflrdqkavgpedlqlfrltdepeevvqalkaeappr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wekA (A:)
    plidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrlgra
    laeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslryffvr
    kvlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflr
    dqkavgpedlqlfrltdepeevvqalka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wekB (B:)
    mpkkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyr
    lgralaeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslry
    ffvrkvlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwl
    aflrdqkavgpedlqlfrltdepeevvqalkaeappr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wekB (B:)
    lidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrlgral
    aeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslryffvrk
    vlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflrd
    qkavgpedlqlfrltdepeevvqalka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wekC (C:)
    mpkkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyr
    lgralaeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslry
    ffvrkvlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwl
    aflrdqkavgpedlqlfrltdepeevvqalkaeappr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wekC (C:)
    pkkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrl
    gralaeagfgvvtgggpgvmeavnrgayeaggvsvglnielpnpyqthalslryffvrkv
    lfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflrdq
    kavgpedlqlfrltdepeevvqalka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wekD (D:)
    mpkkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyr
    lgralaeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslry
    ffvrkvlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwl
    aflrdqkavgpedlqlfrltdepeevvqalkaeappr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wekD (D:)
    kkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrlg
    ralaeagfgvvtgggpgvmeavnrgayeaggvsvglnielpnpyqthalslryffvrkvl
    fvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflrdqk
    avgpedlqlfrltdepeevvqalkaeap
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wekE (E:)
    mpkkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyr
    lgralaeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslry
    ffvrkvlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwl
    aflrdqkavgpedlqlfrltdepeevvqalkaeappr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wekE (E:)
    kplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrlgr
    alaeagfgvvtgggpgvmeavnrgayeaggvsvglniepnpyqthalslryffvrkvlfv
    ryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflrdqkav
    gpedlqlfrltdepeevvqalkaeap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wekF (F:)
    mpkkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyr
    lgralaeagfgvvtgggpgvmeavnrgayeaggvsvglnielpheqkpnpyqthalslry
    ffvrkvlfvryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwl
    aflrdqkavgpedlqlfrltdepeevvqalkaeappr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wekF (F:)
    pkkplidqlhhedswrlfrilaefvegfetlselqvplvsvfgsarfgeghpayeagyrl
    gralaeagfgvvtgggpgvmeavnrgayeaggvsvglnipnpyqthalslryffvrkvlf
    vryavgfvflpggfgtldelsevlvllqtekvhrfpvflldrgyweglvrwlaflrdqka
    vgpedlqlfrltdepeevvqalkae