PDB entry 1wei

View 1wei on RCSB PDB site
Description: Catalytic Domain Of Muty From Escherichia Coli K20A Mutant Complexed To Adenine
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-05-25, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.217
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A/G-specific adenine glycosylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17802 (0-End)
      • engineered (19)
    Domains in SCOPe 2.07: d1weia_
  • Heterogens: ADE, EDO, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1weiA (A:)
    mqasqfsaqvldwydkygratlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
    tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
    tagailslslgkhfpildgnvkrvlarcyavsgwpgkkevenklwslseqvtpavgverf
    nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1weiA (A:)
    mqasqfsaqvldwydkygratlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
    tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
    tagailslslgkhfpildgnvkrvlaryavsgwpgkkevenklwlseqvtpavgverfnq
    ammdlgamctrskpkclcplqngciaaannswalypgkkp