PDB entry 1weh

View 1weh on RCSB PDB site
Description: Crystal structure of the conserved hypothetical protein TT1887 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Rossmann fold, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Conserved hypothetical protein TT1887
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1weha_
  • Chain 'B':
    Compound: Conserved hypothetical protein TT1887
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wehb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wehA (A:)
mrllavfvssrlspedplyarwvrygevlaeegfglacggyqggmealargvkakgglvv
gvtapaffperrgpnpfvdlelpaatlpqrigrlldlgagylalpggvgtlaelvlawnl
lylrrgvgrplavdpywlgllkahgeiapedvgllrvvadeedlrrflrsl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wehB (B:)
mrllavfvssrlspedplyarwvrygevlaeegfglacggyqggmealargvkakgglvv
gvtapaffperrgpnpfvdlelpaatlpqrigrlldlgagylalpggvgtlaelvlawnl
lylrrgvgrplavdpywlgllkahgeiapedvgllrvvadeedlrrflrsl